Return to main results Retrieve Phyre Job Id

Job DescriptionP37647
Confidence18.63%DateThu Jan 5 11:56:19 GMT 2012
Rank99Aligned Residues37
% Identity22%Templatec2iyaB_
PDB info PDB header:transferaseChain: B: PDB Molecule:oleandomycin glycosyltransferase; PDBTitle: the crystal structure of macrolide glycosyltransferases: a2 blueprint for antibiotic engineering
Resolution1.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40.........50..
Predicted Secondary structure 

.












Query SS confidence 

.

















































Query Sequence  MS. KKIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYVT
Query Conservation 
 .  

 

   

            

   
 
  

 
    
       
Alig confidence 

.







...............


























Template Conservation 
 
 


    ...............   

    
 

  
  


 
 
 
Template Sequence  VTPRHISFFNI. . . . . . . . . . . . . . . PGHGHVNPSLGIVQELVARGHRVSYAI
Template Known Secondary structure 





...............S
TT
Template Predicted Secondary structure 





...............





Template SS confidence 




















































   10.........20 .........30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions