Return to main results Retrieve Phyre Job Id

Job DescriptionP37647
Confidence29.57%DateThu Jan 5 11:56:19 GMT 2012
Rank80Aligned Residues31
% Identity26%Templatec1v59B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrolipoamide dehydrogenase; PDBTitle: crystal structure of yeast lipoamide dehydrogenase2 complexed with nad+
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1... .....10.........20.........30.........40.........50.
Predicted Secondary structure 



..










Query SS confidence 



. .














































Query Sequence  MSKK. . IAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYV
Query Conservation 
   ..

 

   

            

   
 
  

 
    
      
Alig confidence 



..




................














....






Template Conservation 
   






................

 


 

  
   ....
  
 

Template Sequence  INKSHDVVIIG. . . . . . . . . . . . . . . . GGPAGYVAAIKAAQL. . . . GFNTACV
Template Known Secondary structure 
................
ST....T

Template Predicted Secondary structure 



................


....

Template SS confidence 




















































   2.......10.. .......20....... ..30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions