Return to main results Retrieve Phyre Job Id

Job DescriptionP11880
Confidence20.89%DateThu Jan 5 11:33:00 GMT 2012
Rank364Aligned Residues39
% Identity26%Templatec1sxjA_
PDB info PDB header:replicationChain: A: PDB Molecule:activator 1 95 kda subunit; PDBTitle: crystal structure of the eukaryotic clamp loader2 (replication factor c, rfc) bound to the dna sliding clamp3 (proliferating cell nuclear antigen, pcna)
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   84.....90...... ...100........ .110.........120..
Predicted Secondary structure 
................





..


Query SS confidence 












. . . . . . . . . . . . . . . .











. .













Query Sequence  RLAFGELAAWVRQ. . . . . . . . . . . . . . . . QVPARVVALTGS. . SGKTSVKEMTAAIL
Query Conservation    

  

     ................     

 



.. 




   
  

Alig confidence 












................











..













Template Conservation     
  
  

  
                   
 







 



 
  




Template Sequence  KGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAAHLVAQEL
Template Known Secondary structure  TTTT



TTSTTS
S
STTSST
Template Predicted Secondary structure 






















Template SS confidence 
























































   314.....320.........330.........340.........350.........360.........370
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions