Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB26
Confidence2.87%DateThu Jan 5 11:14:27 GMT 2012
Rank74Aligned Residues25
% Identity28%Templatec2zxqA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:endo-alpha-n-acetylgalactosaminidase; PDBTitle: crystal structure of endo-alpha-n-acetylgalactosaminidase2 from bifidobacterium longum (engbf)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   152.......160.........170.........180...
Predicted Secondary structure 












Query SS confidence 































Query Sequence  AYVLREDGSQGEAMAKKLAKGIEVKPGEIVIP
Query Conservation 

 
       
 
 
     
 
  


 
 
Alig confidence 







.......
















Template Conservation 





 
.......
     
 
 





 
Template Sequence  VYQLTDQG. . . . . . . KTNEQTVAVSGGKVTLT
Template Known Secondary structure  TT.......
BTT
Template Predicted Secondary structure 



.......



Template SS confidence 































   1053......1060 .........1070.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions