Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB26
Confidence3.17%DateThu Jan 5 11:14:27 GMT 2012
Rank60Aligned Residues26
% Identity8%Templatec2rrlA_
PDB info PDB header:protein transportChain: A: PDB Molecule:flagellar hook-length control protein; PDBTitle: solution structure of the c-terminal domain of the flik
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160.........170.........180.....
Predicted Secondary structure 











Query SS confidence 































Query Sequence  VLREDGSQGEAMAKKLAKGIEVKPGEIVIPFT
Query Conservation   
       
 
 
     
 
  


 
   
Alig confidence 



.....








.












Template Conservation   
 
.....  

 
 
 .
        
   
Template Sequence  RLHP. . . . . EELGQVHIS. LKLDDNQAQLQMV
Template Known Secondary structure 

SS.....GGG

.TT
Template Predicted Secondary structure 
.....



.

Template SS confidence 































   92... ....100.... .....110.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions