Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7T7
Confidence5.38%DateThu Jan 5 11:06:10 GMT 2012
Rank31Aligned Residues30
% Identity40%Templatec3ktsA_
PDB info PDB header:transcriptional regulatorChain: A: PDB Molecule:glycerol uptake operon antiterminator regulatory protein; PDBTitle: crystal structure of glycerol uptake operon antiterminator regulatory2 protein from listeria monocytogenes str. 4b f2365
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60........
Predicted Secondary structure 














Query SS confidence 










































Query Sequence  IATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLL
Query Conservation 
 

  


  






 


  
 



  





  


Alig confidence 
















.............












Template Conservation 
 

      






.............   
  

  

 
Template Sequence  IDFLCTEICPDGIISTR. . . . . . . . . . . . . GNAIMKAKQHKML
Template Known Secondary structure  TT

SS
.............TT
Template Predicted Secondary structure 





.............


Template SS confidence 










































   72.......80........ .90.........100.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions