Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7T7
Confidence4.21%DateThu Jan 5 11:06:10 GMT 2012
Rank44Aligned Residues29
% Identity31%Templatec3d3kD_
PDB info PDB header:protein bindingChain: D: PDB Molecule:enhancer of mrna-decapping protein 3; PDBTitle: crystal structure of human edc3p
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.......
Predicted Secondary structure 













Query SS confidence 



































Query Sequence  YITESGKIVPSRITGTRAKYQRQLARAIKRARYLSL
Query Conservation 


  






 


  
 



  





  

Alig confidence 










....











...





Template Conservation    

 

 

 ....

      

  ...
   

Template Sequence  FCTDSGLVVPS. . . . ISYELHKKLLSV. . . AEKHGL
Template Known Secondary structure 
TT


....

...TT
Template Predicted Secondary structure 





....

...


Template SS confidence 



































   271........280. ........290... ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions