Return to main results Retrieve Phyre Job Id

Job DescriptionP77743
Confidence93.74%DateThu Jan 5 12:32:24 GMT 2012
Rank145Aligned Residues27
% Identity22%Templated1lw7a2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nucleotide and nucleoside kinases
Resolution2.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   242.......250.........260.........270.........
Predicted Secondary structure 



















Query SS confidence 





































Query Sequence  VLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFV
Query Conservation 


 

 



   
  

  
         
   


Alig confidence 





















...........




Template Conservation 


 
  






   

  
...........     
Template Sequence  VAILGGESSGKSVLVNKLAAVF. . . . . . . . . . . NTTSA
Template Known Secondary structure 

TTST...........T
Template Predicted Secondary structure 





...........


Template SS confidence 





































   229230.........240.........250 .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions