Return to main results Retrieve Phyre Job Id

Job DescriptionP77743
Confidence87.78%DateThu Jan 5 12:32:24 GMT 2012
Rank371Aligned Residues32
% Identity38%Templatec3zvmA_
PDB info PDB header:hydrolase/transferase/dnaChain: A: PDB Molecule:bifunctional polynucleotide phosphatase/kinase; PDBTitle: the structural basis for substrate recognition by mammalian2 polynucleotide kinase 3' phosphatase
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   242.......250.........260.........270.........280......
Predicted Secondary structure 




















Query SS confidence 












































Query Sequence  VLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAVNCGAI
Query Conservation 


 

 



   
  

  
         
   


 


   
Alig confidence 

















.............













Template Conservation 




 






 
  
.............    

  

 
 
Template Sequence  VVAVGFPGAGKSTFIQEH. . . . . . . . . . . . . LVSAGYVHVNRDTL
Template Known Secondary structure 

TTSS.............TGGGT
Template Predicted Secondary structure 





.............


Template SS confidence 












































   367..370.........380.... .....390........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions