Return to main results Retrieve Phyre Job Id

Job DescriptionP77743
Confidence91.21%DateThu Jan 5 12:32:24 GMT 2012
Rank258Aligned Residues33
% Identity21%Templatec3fozB_
PDB info PDB header:transferase/rnaChain: B: PDB Molecule:trna delta(2)-isopentenylpyrophosphate transferase; PDBTitle: structure of e. coli isopentenyl-trna transferase in complex with e.2 coli trna(phe)
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   242.......250.........260.........270.........280.......
Predicted Secondary structure 





















Query SS confidence 













































Query Sequence  VLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAVNCGAIA
Query Conservation 


 

 



   
  

  
         
   


 


    
Alig confidence 

















.............














Template Conservation 
 
 







 


 
.............
    







 
Template Sequence  IFLMGPTASGKTALAIEL. . . . . . . . . . . . . RKILPVELISVDSAL
Template Known Secondary structure 

SSS
.............TTTS


SST
Template Predicted Secondary structure 





.............




Template SS confidence 













































   13......20.........30 .........40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions