Return to main results Retrieve Phyre Job Id

Job DescriptionP77743
Confidence92.92%DateThu Jan 5 12:32:24 GMT 2012
Rank184Aligned Residues35
% Identity26%Templatec3akyA_
PDB info PDB header:adenylate kinaseChain: A: PDB Molecule:adenylate kinase; PDBTitle: stability, activity and structure of adenylate kinase2 mutants
Resolution2.23 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   239240.........250.........260.........270.........280......
Predicted Secondary structure 























Query SS confidence 















































Query Sequence  SAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAVNCGAI
Query Conservation    



 

 



   
  

  
         
   


 


   
Alig confidence 

























.............








Template Conservation   
 
 
 
  







  

  
 .............   
    
Template Sequence  SIRMVLIGPPGAGKGTQAPNLQERFH. . . . . . . . . . . . . AAHLATGDM
Template Known Secondary structure 



TTSS
.............
Template Predicted Secondary structure 







.............
Template SS confidence 















































   4.....10.........20......... 30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions