Return to main results Retrieve Phyre Job Id

Job DescriptionP69407
Confidence63.70%DateThu Jan 5 12:11:30 GMT 2012
Rank424Aligned Residues30
% Identity23%Templatec3nrwA_
PDB info PDB header:recombinationChain: A: PDB Molecule:phage integrase/site-specific recombinase; PDBTitle: crystal structure of the n-terminal domain of phage integrase/site-2 specific recombinase (tnp) from haloarcula marismortui, northeast3 structural genomics consortium target hmr208a
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   176...180.........190.........200.........210....
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  NRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPAD
Query Conservation   

  

  
   
  

   
  


  
   


   
Alig confidence 















.........













Template Conservation   

  

      

 .........

  
     
  
Template Sequence  DVSPATLNGEXQTLKN. . . . . . . . . WLEYLARIDVVDED
Template Known Secondary structure  S

.........TTSS
TT
Template Predicted Secondary structure 


.........






Template SS confidence 






































   70.........80..... ....90.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions