Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC51
Confidence27.68%DateThu Jan 5 11:17:11 GMT 2012
Rank446Aligned Residues42
% Identity29%Templatec3o60A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:lin0861 protein; PDBTitle: the crystal structure of lin0861 from listeria innocua to 2.8a
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10......... 20.........30.........40.........50.........60.....
Predicted Secondary structure 
.
















Query SS confidence 

















.













































Query Sequence  EKTTTQELLAQAEKICAQ. RNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYR
Query Conservation                 
  . 


 
  
  

  
     
 

 

   
      

 




Alig confidence 

















.





.................








.....








Template Conservation     

  
  

  

 
 


   .................

  

  
.....


 



 
Template Sequence  TQKTQTKLYTVLERFYVEDRTFESI. . . . . . . . . . . . . . . . . SIKDLCEQA. . . . . RVSRATFYR
Template Known Secondary structure  TT

TTT
.................
.....T

Template Predicted Secondary structure 






.................
.....




Template SS confidence 
































































   17..20.........30.........40. ........50 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions