Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC51
Confidence23.62%DateThu Jan 5 11:17:11 GMT 2012
Rank491Aligned Residues41
% Identity20%Templatec3mnlA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulatory protein (probably tetr-family); PDBTitle: the crystal structure of kstr (rv3574) from mycobacterium tuberculosis2 h37rv
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.....
Predicted Secondary structure 
















Query SS confidence 






























































Query Sequence  KTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYR
Query Conservation                
   


 
  
  

  
     
 

 

   
      

 




Alig confidence 





















.................









.....








Template Conservation     
  

 

  
    
   ................. 

  

  
.....


  
 
 
Template Sequence  RERRKRILDATMAIASKGGYEA. . . . . . . . . . . . . . . . . VQMRAVADRA. . . . . DVAVGTLYR
Template Known Secondary structure  .................

.....T

Template Predicted Secondary structure 



.................

.....



Template SS confidence 






























































   15....20.........30...... ...40...... ...50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions