Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC51
Confidence44.28%DateThu Jan 5 11:17:11 GMT 2012
Rank315Aligned Residues42
% Identity21%Templatec3lwjA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:putative tetr-family transcriptional regulator; PDBTitle: crystal structure of putative tetr-family transcriptional regulator2 (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a3 resolution
Resolution2.07 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60.....
Predicted Secondary structure 

















Query SS confidence 































































Query Sequence  EKTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYR
Query Conservation                 
   


 
  
  

  
     
 

 

   
      

 




Alig confidence 























.................








.....








Template Conservation    


  

 

  
    
    .................

  

  
.....


  
 
 
Template Sequence  NKERRQKILTCSLDLFIEKGYYNT. . . . . . . . . . . . . . . . . SIRDIIALS. . . . . EVGTGTFYN
Template Known Secondary structure 
TTT
.................
.....
S
Template Predicted Secondary structure 





.................
.....


Template SS confidence 































































   910.........20.........30.. .......40. ........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions