Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC51
Confidence27.27%DateThu Jan 5 11:17:11 GMT 2012
Rank447Aligned Residues40
% Identity20%Templatec2fbqA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:probable transcriptional regulator; PDBTitle: the crystal structure of transcriptional regulator pa3006
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.....
Predicted Secondary structure 
















Query SS confidence 





























































Query Sequence  TTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYR
Query Conservation               
   


 
  
  

  
     
 

 

   
      

 




Alig confidence 


















.................











.....








Template Conservation   

  

 

  

 
 
 .................   

  

  
.....


  


 
Template Sequence  ETVERILDAAEQLFAEKGF. . . . . . . . . . . . . . . . . AETSLRLITSKA. . . . . GVNLAAVNY
Template Known Secondary structure 
S.................TT

.....TS
Template Predicted Secondary structure 

.................



.....


Template SS confidence 





























































   5....10.........20... ......30..... ....40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions