Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC51
Confidence43.11%DateThu Jan 5 11:17:11 GMT 2012
Rank320Aligned Residues25
% Identity8%Templatec1z4hA_
PDB info PDB header:protein binding, dna binding proteinChain: A: PDB Molecule:tor inhibition protein; PDBTitle: the response regulator tori belongs to a new family of2 atypical excisionase
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60........
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  DGAISAYDLLDLLREAEPQAKPPTVYRALD
Query Conservation    
 

 

   
      

 




 
 
Alig confidence 












.....











Template Conservation    

    
    .....







    
Template Sequence  DSLVDLKFIMADT. . . . . GFGKTFIYDRIK
Template Known Secondary structure  SS
.....SS
Template Predicted Secondary structure 




.....


Template SS confidence 





























   8.10.........20 .........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions