Return to main results Retrieve Phyre Job Id

Job DescriptionQ46840
Confidence95.59%DateThu Jan 5 12:35:05 GMT 2012
Rank159Aligned Residues62
% Identity13%Templatec2p0wB_
PDB info PDB header:transferaseChain: B: PDB Molecule:histone acetyltransferase type b catalytic subunit; PDBTitle: human histone acetyltransferase 1 (hat1)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   238.240.........250 .........260.........270.........280.........290.........300.........310
Predicted Secondary structure 




.......






















Query SS confidence 












. . . . . . .



























































Query Sequence  PDDMIYIAEIDSA. . . . . . . PCAFIVGLPNINEAIADLNGSLFPFGWAKLLWRLKVSGVRTARVPLMGVRDEYQFSRIGP
Query Conservation 
     


  
 ....... 


    

         
 
   
    
            
  


 

 

 


 
Alig confidence 












.......







.......................




























Template Conservation   
  
 
 

        
  


 
 
....................... 

 

   
 



 






  
 
 
Template Sequence  RWHYFLVFEKYNKDGATLFATVGYMTVY. . . . . . . . . . . . . . . . . . . . . . . NYYVYPDKTRPRVSQMLILTPFQGQGHGA
Template Known Secondary structure  TTT.......................TTT
GGGTTSS
Template Predicted Secondary structure 







.......................















Template SS confidence 















































































   198.200.........210.........220..... ....230.........240.........250....
 
   311........320..
Predicted Secondary structure 
Query SS confidence 











Query Sequence  VIALLLIEALRD
Query Conservation   
       
  
Alig confidence 











Template Conservation   
   

     
Template Sequence  QLLETVHRYYTE
Template Known Secondary structure  T
Template Predicted Secondary structure 
Template SS confidence 











   255....260......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions