Return to main results Retrieve Phyre Job Id

Job DescriptionP0AES4
Confidence15.38%DateThu Jan 5 11:24:06 GMT 2012
Rank82Aligned Residues49
% Identity22%Templatec2oszA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:nucleoporin p58/p45; PDBTitle: structure of nup58/45 suggests flexible nuclear pore diameter by2 intermolecular sliding
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   471........480.........490...... ...500.........510.........
Predicted Secondary structure 

.........................




Query SS confidence 

























. . . . . . . . . . . . . . . . . . . . . . . . .






















Query Sequence  HEKLLDEYKELLDQIAELLRILGSAD. . . . . . . . . . . . . . . . . . . . . . . . . RLMEVIREELELVREQFGDKRRT
Query Conservation    

  
   
   
  
  

    .........................     
  

  

   
  


Alig confidence 

























.........................






















Template Conservation 
  

 

  

 


 

  
 
 
     


 
   
      





 
  

  
  

  

  

 
Template Sequence  VQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLSYRKM
Template Known Secondary structure  S


Template Predicted Secondary structure 







Template SS confidence 









































































   336...340.........350.........360.........370.........380.........390.........400.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions