Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence80.62%DateThu Jan 5 12:03:01 GMT 2012
Rank72Aligned Residues30
% Identity20%Templatec3kd9B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:coenzyme a disulfide reductase; PDBTitle: crystal structure of pyridine nucleotide disulfide oxidoreductase from2 pyrococcus horikoshii
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30....... ..40....
Predicted Secondary structure 










..


Query SS confidence 




































. .






Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRY. . GIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  
..
  
   
Alig confidence 







..............














..






Template Conservation 







..............

 


 

  
        
 

Template Sequence  LKKVVIIG. . . . . . . . . . . . . . GGAAGMSAASRVKRLKPEWDVKVF
Template Known Secondary structure 


..............
S
TTS
Template Predicted Secondary structure 


..............





Template SS confidence 













































   3......10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions