Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence24.90%DateThu Jan 5 12:03:01 GMT 2012
Rank170Aligned Residues28
% Identity25%Templatec3g05B_
PDB info PDB header:rna binding proteinChain: B: PDB Molecule:trna uridine 5-carboxymethylaminomethyl modification enzyme PDBTitle: crystal structure of n-terminal domain (2-550) of e.coli mnmg
Resolution3.49 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40....
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation   
  

   

          

   
 
  
  

  
   
Alig confidence 





..............





















Template Conservation 





..............

 


 

  


 
 




Template Sequence  DVIIIG. . . . . . . . . . . . . . GGHAGTEAAMAAARMGQQTLLL
Template Known Secondary structure  S..............
ST

Template Predicted Secondary structure 

..............





Template SS confidence 









































   8.10... ......20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions