Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence36.77%DateThu Jan 5 12:03:01 GMT 2012
Rank122Aligned Residues30
% Identity23%Templatec3atrA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:conserved archaeal protein; PDBTitle: geranylgeranyl reductase (ggr) from sulfolobus acidocaldarius co-2 crystallized with its ligand
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40....
Predicted Secondary structure 

.











Query SS confidence 

.









































Query Sequence  MK. TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
 . 
  

   

          

   
 
  
  

  
   
Alig confidence 

.





..............





















Template Conservation    






..............

 


 

  

  
  
 

Template Sequence  LKYDVLIIG. . . . . . . . . . . . . . GGFAGSSAAYQLSRRGLKILLV
Template Known Secondary structure 
S
..............
SSSSS

Template Predicted Secondary structure 


..............




Template SS confidence 












































   4.....10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions