Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence27.23%DateThu Jan 5 12:03:01 GMT 2012
Rank162Aligned Residues30
% Identity27%Templatec2xdoC_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:tetx2 protein; PDBTitle: structure of the tetracycline degrading monooxygenase tetx2 from2 bacteroides thetaiotaomicron
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40....
Predicted Secondary structure 

..











Query SS confidence 

. .









































Query Sequence  MK. . TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
 .. 
  

   

          

   
 
  
  

  
   
Alig confidence 

..





..............





















Template Conservation 
   

 


..............

 


  
  

  
  
 

Template Sequence  LSDKNVAIIG. . . . . . . . . . . . . . GGPVGLTMAKLLQQNGIDVSVY
Template Known Secondary structure 
TT

..............
STTT
Template Predicted Secondary structure 





..............




Template SS confidence 













































   14.....20... ......30.........40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions