Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence55.44%DateThu Jan 5 12:03:01 GMT 2012
Rank91Aligned Residues30
% Identity17%Templatec2weuD_
PDB info PDB header:antifungal proteinChain: D: PDB Molecule:tryptophan 5-halogenase; PDBTitle: crystal structure of tryptophan 5-halogenase (pyrh) complex2 with substrate tryptophan
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30....... ..40....
Predicted Secondary structure 










...


Query SS confidence 




































. . .






Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRY. . . GIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  
...
  
   
Alig confidence 







..............














...






Template Conservation 

 




..............

 

  

  


    
  



Template Sequence  IRSVVIVG. . . . . . . . . . . . . . GGTAGWMTASYLKAAFDDRIDVTLV
Template Known Secondary structure 


..............
GGGS
Template Predicted Secondary structure 


..............




Template SS confidence 














































   2....... 10.........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions