Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence23.46%DateThu Jan 5 12:03:01 GMT 2012
Rank180Aligned Residues29
% Identity21%Templatec2e1mA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:l-glutamate oxidase; PDBTitle: crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40....
Predicted Secondary structure 












Query SS confidence 










































Query Sequence  KTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation    
  

   

          

   
 
  
  

  
   
Alig confidence 






..............





















Template Conservation 






..............








  
   
  
 

Template Sequence  KRILIVG. . . . . . . . . . . . . . AGIAGLVAGDLLTRAGHDVTIL
Template Known Secondary structure 

..............
BTS
Template Predicted Secondary structure 

..............





Template SS confidence 










































   5960..... ....70.........80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions