Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence48.24%DateThu Jan 5 12:03:01 GMT 2012
Rank101Aligned Residues30
% Identity27%Templatec2bs3A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:quinol-fumarate reductase flavoprotein subunit a; PDBTitle: glu c180 -> gln variant quinol:fumarate reductase from2 wolinella succinogenes
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40....
Predicted Secondary structure 

....











Query SS confidence 

. . . .









































Query Sequence  MK. . . . TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
 .... 
  

   

          

   
 
  
  

  
   
Alig confidence 

....





..............





















Template Conservation 
     





..............

 


 


 


 
 

 

Template Sequence  MKVQYCDSLVIG. . . . . . . . . . . . . . GGLAGLRAAVATQQKGLSTIVL
Template Known Secondary structure 


S
..............
STTT

Template Predicted Secondary structure 


..............





Template SS confidence 















































   1........10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions