Return to main results Retrieve Phyre Job Id

Job DescriptionP45543
Confidence29.94%DateThu Jan 5 12:03:01 GMT 2012
Rank146Aligned Residues29
% Identity14%Templatec1nhqA_
PDB info PDB header:oxidoreductase (h2o2(a))Chain: A: PDB Molecule:nadh peroxidase; PDBTitle: crystallographic analyses of nadh peroxidase cys42ala and cys42ser2 mutants: active site structure, mechanistic implications, and an3 unusual environment of arg303
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30....... ..40....
Predicted Secondary structure 










..


Query SS confidence 




































. .






Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRY. . GIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  
..
  
   
Alig confidence 

.




..............














..






Template Conservation 

.




..............

 


 

  
        
 

Template Sequence  MK. VIVLG. . . . . . . . . . . . . . SSHGGYEAVEELLNLHPDAEIQWY
Template Known Secondary structure 
.
..............SS
TTS
Template Predicted Secondary structure 
.
..............





Template SS confidence 













































   1. ..... ..10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions