Return to main results Retrieve Phyre Job Id

Job DescriptionP76038
Confidence54.16%DateThu Jan 5 12:17:38 GMT 2012
Rank124Aligned Residues40
% Identity18%Templatec3o8oC_
PDB info PDB header:transferaseChain: C: PDB Molecule:6-phosphofructokinase subunit alpha; PDBTitle: structure of phosphofructokinase from saccharomyces cerevisiae
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110.........120
Predicted Secondary structure 


























Query SS confidence 
























































Query Sequence  GIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICRGLQEL
Query Conservation 



 

     
               
      

  
     





 
 


Alig confidence 











.................



























Template Conservation 











.................

 




  
   
  
 

  

 

Template Sequence  AVMTSGGDSPGM. . . . . . . . . . . . . . . . . NAAVRAVVRTGIHFGCDVFAVYEGYEGL
Template Known Secondary structure  SS

TT.................TT
TT
Template Predicted Secondary structure 




.................




Template SS confidence 
























































   209210.........220 .........230.........240........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions