Return to main results Retrieve Phyre Job Id

Job DescriptionP76038
Confidence33.65%DateThu Jan 5 12:17:38 GMT 2012
Rank160Aligned Residues40
% Identity18%Templatec2iirJ_
PDB info PDB header:transferaseChain: J: PDB Molecule:acetate kinase; PDBTitle: acetate kinase from a hypothermophile thermotoga maritima
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   54.....60.........70.........80.........90.........100.........110.....
Predicted Secondary structure 




























Query SS confidence 





























































Query Sequence  LLEQLLPKLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMAIINAALERRIPIFAICR
Query Conservation   
   
  





 

     
               
      

  
     





 
Alig confidence 
















........




..............

















Template Conservation 
 

 











........




..............  

  
   
  


 
Template Sequence  AYAAAMNGVDAIVFTAG. . . . . . . . VGENS. . . . . . . . . . . . . . PITREDVCSYLEFLGVKL
Template Known Secondary structure  T

S........TT
..............TTGGGT

B
Template Predicted Secondary structure 







........



..............




Template SS confidence 





























































   315....320.........330. ..... ...340.........350....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions