Return to main results Retrieve Phyre Job Id

Job DescriptionP0A744
Confidence91.89%DateThu Jan 5 11:04:46 GMT 2012
Rank30Aligned Residues45
% Identity27%Templatec3j09A_
PDB info PDB header:hydrolase, metal transportChain: A: PDB Molecule:copper-exporting p-type atpase a; PDBTitle: high resolution helical reconstruction of the bacterial p-type atpase2 copper transporter copa
Resolution10.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.........90.........100.........110.....
Predicted Secondary structure 

























Query SS confidence 































































Query Sequence  CFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVF
Query Conservation 



 
  
  
 

  
 





    


  

 
 


 
 
 
 


  


  

  
Alig confidence 
























...................



















Template Conservation 
   

  
    

    

    ...................   
  
        
   
Template Sequence  CVKSIETAVGSLEGVEEVRVNLATE. . . . . . . . . . . . . . . . . . . TAFIRFDEKRIDFETIKRVI
Template Known Secondary structure  TSTTTTTT...................
TTT

Template Predicted Secondary structure 





...................





Template SS confidence 































































   30.........40.........50.... .....60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions