Return to main results Retrieve Phyre Job Id

Job DescriptionP0A744
Confidence92.11%DateThu Jan 5 11:04:46 GMT 2012
Rank26Aligned Residues46
% Identity35%Templatec2ropA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:copper-transporting atpase 2; PDBTitle: solution structure of domains 3 and 4 of human atp7b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........90.........100.........110....
Predicted Secondary structure 

























Query SS confidence 
































































Query Sequence  MGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQV
Query Conservation 





 
  
  
 

  
 





    


  

 
 


 
 
 
 


  


  

  
Alig confidence 


























...................


















Template Conservation    
   

  
    

  
 
     ...................   
 
         
   
Template Sequence  ASCVHSIEGMISQLEGVQQISVSLAEG. . . . . . . . . . . . . . . . . . . TATVLYNPAVISPEELRAA
Template Known Secondary structure  TGGGSSSTTTT...................
TTT

Template Predicted Secondary structure 






...................




Template SS confidence 
































































   134.....140.........150.........160 .........170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions