Return to main results Retrieve Phyre Job Id

Job DescriptionP0A744
Confidence56.76%DateThu Jan 5 11:04:46 GMT 2012
Rank43Aligned Residues33
% Identity24%Templatec2phcB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein ph0987; PDBTitle: crystal structure of conserved uncharacterized protein ph0987 from2 pyrococcus horikoshii
Resolution2.29 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   61........70.........80.........90.........100.........110....
Predicted Secondary structure 

























Query SS confidence 





















































Query Sequence  WQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQV
Query Conservation    
 

  
 





    


  

 
 


 
 
 
 


  


  

  
Alig confidence 













.....................


















Template Conservation      

 
 

   .....................



 


       
   
Template Sequence  ESPEWLVELVPAYS. . . . . . . . . . . . . . . . . . . . . SLLVIYDPLKASYEEVESY
Template Known Secondary structure 

TTTT.....................
TTTS
Template Predicted Secondary structure 








.....................





Template SS confidence 





















































   37..40.........50 .........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions