Return to main results Retrieve Phyre Job Id

Job DescriptionP0A744
Confidence93.93%DateThu Jan 5 11:04:46 GMT 2012
Rank15Aligned Residues47
% Identity19%Templatec1yjrA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:copper-transporting atpase 1; PDBTitle: solution structure of the apo form of the sixth soluble2 domain a69p mutant of menkes protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........90.........100.........110.....
Predicted Secondary structure 

























Query SS confidence 

































































Query Sequence  MGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVF
Query Conservation 





 
  
  
 

  
 





    


  

 
 


 
 
 
 


  


  

  
Alig confidence 


























...................



















Template Conservation    
   
   
    

    
     ................... 
 
  
        
   
Template Sequence  ASCVHKIESSLTKHRGILYCSVALATN. . . . . . . . . . . . . . . . . . . KAHIKYDPEIIGPRDIIHTI
Template Known Secondary structure  TTTTSTTTTTT...................
TTTT
Template Predicted Secondary structure 







...................




Template SS confidence 

































































   16...20.........30.........40.. .......50.........60..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions