Return to main results Retrieve Phyre Job Id

Job DescriptionP30850
Confidence97.20%DateWed Jan 25 15:20:48 GMT 2012
Rank49Aligned Residues65
% Identity23%Templatec1hh2P_
PDB info PDB header:transcription regulationChain: P: PDB Molecule:n utilization substance protein a; PDBTitle: crystal structure of nusa from thermotoga maritima
Resolution2.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   554.....560.........570.........580.........590.........600.........610.........620.........630...
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  LKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVTDVIDVTIAEVRM
Query Conservation 
    
    
 
 
  
   
  
 
     

 
    
                         


 
 
 
  

 
Alig confidence 






..

















..












..................



















Template Conservation 
  



..

 
 
 

   
  


..

 

 

  
 
..................
 
    

 


 
  

 
Template Sequence  YSELKGT. . VTTAEVIRVMGEWADIRI. . GKLETRLPKKEWI. . . . . . . . . . . . . . . . . . PGEEIKAGDLVKVYIIDVVK
Template Known Secondary structure  TT

TT
..
SS..TTGGGS
..................TT



TT
Template Predicted Secondary structure 


..


..



..................









Template SS confidence 















































































   130...... ...140.........150.... .....160....... ..170.........180.......
 
   634.. ...640
Predicted Secondary structure 


..
Query SS confidence 


. .



Query Sequence  ETR. . SIIA
Query Conservation     .. 
  
Alig confidence 


..



Template Conservation    

  
 
Template Sequence  TTKGPKILV
Template Known Secondary structure  TT
Template Predicted Secondary structure 




Template SS confidence 








   188.190......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions