Return to main results Retrieve Phyre Job Id

Job DescriptionP75718
Confidence32.69%DateThu Jan 5 12:13:28 GMT 2012
Rank209Aligned Residues29
% Identity21%Templatec3tdqB_
PDB info PDB header:cell adhesionChain: B: PDB Molecule:pily2 protein; PDBTitle: crystal structure of a fimbrial biogenesis protein pily22 (pily2_pa4555) from pseudomonas aeruginosa pao1 at 2.10 a resolution
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.......
Predicted Secondary structure 












Query SS confidence 




































Query Sequence  ARAGILVVDGKVWRTVYYRFATREEWEGKVSTNLIFK
Query Conservation   


 

  
   
 
 

 

 

  

 


 
 
Alig confidence 











.....













...


Template Conservation   
  

 

   .....





    
 

...


Template Sequence  VEKNLVDIDHRL. . . . . YRLPNSTVRNGXPS. . . LFQ
Template Known Secondary structure  GGGTTT.....

TT
TTG...GGT
Template Predicted Secondary structure 





.....










...
Template SS confidence 




































   35....40...... ...50.........60 ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions