Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7E1
Confidence93.18%DateThu Jan 5 11:05:27 GMT 2012
Rank251Aligned Residues68
% Identity16%Templatec3ceuA_
PDB info PDB header:transferaseChain: A: PDB Molecule:thiamine phosphate pyrophosphorylase; PDBTitle: crystal structure of thiamine phosphate pyrophosphorylase2 (bt_0647) from bacteroides thetaiotaomicron. northeast3 structural genomics consortium target btr268
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   233......240.........250.........260.........270.........280.........290.........300.........310..
Predicted Secondary structure 








































Query SS confidence 















































































Query Sequence  SLVRHNIDGVIATNTTLDRSLVQGMKNCDQTGGLSGRPLQLKSTEIIRRLSLELNGRLPIIGVGGIDSVIAAREKIAAGA
Query Conservation       




 
 
                 

 

      

  
  
       



  


  
 

 
 
  

Alig confidence 











.......................































.











Template Conservation   
    



  .......................



 
 

              

 




 .  

      

Template Sequence  KNRKHFYDYVFX. . . . . . . . . . . . . . . . . . . . . . . SPIYSTYTAEELREAQKAKIIDSKVXALGGIN. EDNLLEIKDFGF
Template Known Secondary structure  TTGGGSS.......................







TT
SSTTSS

.TTTTT
Template Predicted Secondary structure 



.......................




















.


Template SS confidence 















































































   102.......110... ......120.........130.........140..... ....150.......
 
   313......320....
Predicted Secondary structure 


Query SS confidence 











Query Sequence  SLVQIYSGFIFK
Query Conservation 
 
 
 
     
Alig confidence 











Template Conservation   



 


   
Template Sequence  GGAVVLGDLWNK
Template Known Secondary structure  SSTT
Template Predicted Secondary structure 


Template SS confidence 











   167..170........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions