Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP77682
DateThu Jan 5 12:31:37 GMT 2012
Unique Job ID841f89a91f5ffc01

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2kncA_
Top template information
PDB header:cell adhesion
Chain: A: PDB Molecule:integrin alpha-iib;
PDBTitle: platelet integrin alfaiib-beta3 transmembrane-cytoplasmic2 heterocomplex
Confidence and coverage
Confidence: 25.9% Coverage: 26%
31 residues ( 26% of your sequence) have been modelled with 25.9% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MLKLFAKYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKA
Secondary structure 








SS confidence 



























































Disorder  ?





























?



























Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.........120
Sequence  STTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVFRDAK
Secondary structure 





SS confidence 



























































Disorder 




























?
























?????
Disorder confidence 



























































 
  
Sequence 
Secondary structure 
SS confidence 
Disorder 
Disorder confidence 
 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 2knc chain A

3D model

Region: 90 - 120
Aligned: 31
Modelled: 31
Confidence: 25.9%
Identity: 6%
PDB header:cell adhesion
Chain: A: PDB Molecule:integrin alpha-iib;
PDBTitle: platelet integrin alfaiib-beta3 transmembrane-cytoplasmic2 heterocomplex

Phyre2

PDB 2k1a chain A

3D model

Region: 93 - 120
Aligned: 28
Modelled: 28
Confidence: 19.6%
Identity: 7%
PDB header:cell adhesion
Chain: A: PDB Molecule:integrin alpha-iib;
PDBTitle: bicelle-embedded integrin alpha(iib) transmembrane segment

Phyre2
1

c2kncA_
2

c2k1aA_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c2kncA_



25.9 6 PDB header:cell adhesion
Chain: A: PDB Molecule:integrin alpha-iib;
PDBTitle: platelet integrin alfaiib-beta3 transmembrane-cytoplasmic2 heterocomplex
2c2k1aA_



19.6 7 PDB header:cell adhesion
Chain: A: PDB Molecule:integrin alpha-iib;
PDBTitle: bicelle-embedded integrin alpha(iib) transmembrane segment

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0