Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7E9
Confidence27.74%DateThu Jan 5 11:05:32 GMT 2012
Rank63Aligned Residues51
% Identity20%Templatec2i55C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:phosphomannomutase; PDBTitle: complex of glucose-1,6-bisphosphate with phosphomannomutase from2 leishmania mexicana
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190.........200.........210.........220.........230.
Predicted Secondary structure 
































Query SS confidence 





































































Query Sequence  LKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVM
Query Conservation 
 







  

     
  
  
   
    
    
  
   
   

 
 
 

  
  
   
 
Alig confidence 




















...................





























Template Conservation 

  






     
    ...................  

  
   

 
 




          
Template Sequence  ILLFDVDGTLTPPRNPETHDM. . . . . . . . . . . . . . . . . . . KEALLKARAAGFKLGVVGGSDFAKQKEQLG
Template Known Secondary structure  STTTTSSTTS


...................TT
SS

Template Predicted Secondary structure 












...................






Template SS confidence 





































































   6...10.........20...... ...30.........40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions