Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7E9
Confidence11.74%DateThu Jan 5 11:05:32 GMT 2012
Rank100Aligned Residues37
% Identity38%Templatec1kjjA_
PDB info PDB header:transferaseChain: A: PDB Molecule:phosphoribosylglycinamide formyltransferase 2; PDBTitle: crystal structure of glycniamide ribonucleotide2 transformylase in complex with mg-atp-gamma-s
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.....
Predicted Secondary structure 




















Query SS confidence 




















































Query Sequence  TNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVI
Query Conservation         
 







 
            
  
   
  
   
  



 
Alig confidence 











.






...............

















Template Conservation          



.

 
   ...............     

   
  
  

Template Sequence  TALRPAATRVML. LGSGELG. . . . . . . . . . . . . . . KEVAIECQRLGVEVIAVD
Template Known Secondary structure 
TTSTT

.

S...............TTT
Template Predicted Secondary structure 






.


...............


Template SS confidence 




















































   6...10....... ..20.... .....30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions