Return to main results Retrieve Phyre Job Id

Job DescriptionP76509
Confidence4.68%DateThu Jan 5 12:23:48 GMT 2012
Rank49Aligned Residues26
% Identity19%Templatec2rbfB_
PDB info PDB header:oxidoreductase/dnaChain: B: PDB Molecule:bifunctional protein puta; PDBTitle: structure of the ribbon-helix-helix domain of escherichia coli puta2 (puta52) complexed with operator dna (o2)
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40
Predicted Secondary structure 













Query SS confidence 

































Query Sequence  QALVELRNKPAHELKEVGDQWRTPDNIFWGINTL
Query Conservation    
          

 
 
 
 

  

  
   
Alig confidence 











........













Template Conservation    

  
 



........



 

  




Template Sequence  KSAATRIDRTPH. . . . . . . . WLIKQAIFSYLEQL
Template Known Secondary structure  TT

........
Template Predicted Secondary structure 


........
Template SS confidence 

































   1920.........30 .........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions