Return to main results Retrieve Phyre Job Id

Job DescriptionP25748
Confidence87.15%DateThu Jan 5 11:42:36 GMT 2012
Rank403Aligned Residues42
% Identity10%Templatec1p4xA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:staphylococcal accessory regulator a homologue; PDBTitle: crystal structure of sars protein from staphylococcus aureus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20... .... ..30.........40...
Predicted Secondary structure 





..............



.....

Query SS confidence 





















. . . . . . . . . . . . . .



. . . . .















Query Sequence  ITIRDVARQAGVSVATVSRVLN. . . . . . . . . . . . . . NSTL. . . . . VSADTREAVMKAVSEL
Query Conservation 


 


  



  






..............    .....

  

 

   
  
Alig confidence 





















..............



.....















Template Conservation 

  


  
  
 
 

  
  
  

 
 
     
 
   
 

  
   
       
Template Sequence  LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLF
Template Known Secondary structure  SSS
GGGTTTS

SSSTTS

Template Predicted Secondary structure 













Template SS confidence 




























































   51........60.........70.........80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions