Return to main results Retrieve Phyre Job Id

Job DescriptionP0A812
Confidence95.88%DateThu Jan 5 11:06:35 GMT 2012
Rank470Aligned Residues30
% Identity27%Templatec4a2iV_
PDB info PDB header:ribosome/hydrolaseChain: V: PDB Molecule:putative ribosome biogenesis gtpase rsga; PDBTitle: cryo-electron microscopy structure of the 30s subunit in complex with2 the yjeq biogenesis factor
Resolution16.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40.........50.........60.........70.....
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  RSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIV
Query Conservation     
   
            


 










  
Alig confidence 









........



















Template Conservation 
  
   
  ........      
 









 
Template Sequence  LKPLEEALTG. . . . . . . . RISIFAGQSGVGKSSLLNAL
Template Known Secondary structure  TT........S

TTSS
Template Predicted Secondary structure 

........







Template SS confidence 





































   206...210..... ....220.........230.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions