Return to main results Retrieve Phyre Job Id

Job DescriptionP0A812
Confidence97.82%DateThu Jan 5 11:06:35 GMT 2012
Rank206Aligned Residues36
% Identity31%Templatec3b85A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:phosphate starvation-inducible protein; PDBTitle: crystal structure of predicted phosphate starvation-induced atpase2 phoh2 from corynebacterium glutamicum
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70.........
Predicted Secondary structure 













Query SS confidence 














































Query Sequence  GQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEM
Query Conservation 
 
     
   
            


 










  

  
Alig confidence 










...........
























Template Conservation   
  

     ...........     
 







         
Template Sequence  GQKHYVDAIDT. . . . . . . . . . . NTIVFGLGPAGSGKTYLAXAKAVQA
Template Known Secondary structure  ...........
S

TTSSTT
Template Predicted Secondary structure 
...........







Template SS confidence 














































   123......130... ......140.........150........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions