Return to main results Retrieve Phyre Job Id

Job DescriptionP64574
Confidence3.68%DateThu Jan 5 12:09:35 GMT 2012
Rank43Aligned Residues36
% Identity33%Templatec3ofeB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:ldlr chaperone boca; PDBTitle: structured domain of drosophila melanogaster boca p41 2 2 crystal form
Resolution2.29 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.. .......80..
Predicted Secondary structure 



.............



Query SS confidence 

























. . . . . . . . . . . . .









Query Sequence  TGDRQLSAWEAGILTRRYGLDKEMVM. . . . . . . . . . . . . DFFRENNSCS
Query Conservation   



 

 


 
 







 
 ............. 

 
     
Alig confidence 

























.............









Template Conservation     
 
 


  
 
  
 

 

 

 
 

  
 
 



  
 
  
Template Sequence  TKLWQTSLWNNHIQAERYXVDDNRAIFLFKDGTQAWDAKDFLIEQERCK
Template Known Secondary structure  TT

TTSSTTSTT
Template Predicted Secondary structure 










Template SS confidence 
















































   113......120.........130.........140.........150.........160.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions