Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAZ7
Confidence23.79%DateThu Jan 5 11:14:13 GMT 2012
Rank120Aligned Residues27
% Identity37%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910...... ...20.........30......
Predicted Secondary structure 






.................









Query SS confidence 







. . . . . . . . . . . . . . . . .



















Query Sequence  IACPVCNG. . . . . . . . . . . . . . . . . KLWYNQEKQELICKLDNLAF
Query Conservation 
 

 
  ................. 
        
 
  
   
Alig confidence 







.................




.













Template Conservation 



 

               

    
 .      
  


  
Template Sequence  MKCPVCHQGEMVSGIKDIPYTFRGRKTVLK. GIHGLYCVHCEESI
Template Known Secondary structure 
B
TTTSSSBTT.TTT

Template Predicted Secondary structure 










.








Template SS confidence 












































   1........10.........20.........30 .........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions