Return to main results Retrieve Phyre Job Id

Job DescriptionQ46789
Confidence3.99%DateThu Jan 5 12:34:10 GMT 2012
Rank6Aligned Residues31
% Identity32%Templatec2xfeA_
PDB info PDB header:sugar binding proteinChain: A: PDB Molecule:vcbm60; PDBTitle: vcbm60 in complex with galactobiose
Resolution1.82 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........
Predicted Secondary structure 


















Query SS confidence 










































Query Sequence  ANATGDEVVSLDKHINTSATDTDQIQAFIVSTWMAPFQNDMYS
Query Conservation 
 












 


















 






Alig confidence 










............



















Template Conservation   
  
 
 
 
............ 


  
 




     

Template Sequence  RGVNGQESVSL. . . . . . . . . . . . QVGGTTVQTWTLTTAMQDYT
Template Known Secondary structure  SSS

............TT

SS
Template Predicted Secondary structure 




............

Template SS confidence 










































   910......... 20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions