Return to main results Retrieve Phyre Job Id

Job DescriptionP67699
Confidence69.57%DateThu Jan 5 12:10:48 GMT 2012
Rank261Aligned Residues35
% Identity14%Templatec3gbgA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:tcp pilus virulence regulatory protein; PDBTitle: crystal structure of toxt from vibrio cholerae o395
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........
Predicted Secondary structure 















Query SS confidence 

















































Query Sequence  LNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLN
Query Conservation   



 


   


   

 

 
    
      

  



    
 
Alig confidence 























..............
.









Template Conservation     

  

    

   
 
 

.............. . 
 
   

 
Template Sequence  RNWRWADICGELRTNRMILKKELE. . . . . . . . . . . . . . S. RGVKFRELIN
Template Known Secondary structure  S


T

..............T.TT

Template Predicted Secondary structure 






...............



Template SS confidence 

















































   184.....190.........200....... . .210........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions