Return to main results Retrieve Phyre Job Id

Job DescriptionP39286
Confidence98.72%DateThu Jan 5 11:58:58 GMT 2012
Rank61Aligned Residues64
% Identity22%Templatec3p1jC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:gtpase imap family member 2; PDBTitle: crystal structure of human gtpase imap family member 2 in the2 nucleotide-free state
Resolution2.58 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   209210.........220.........230.........240.........250.........260.........270.........280........
Predicted Secondary structure 









































Query SS confidence 















































































Query Sequence  ISIFAGQSGVGKSSLLNALLGLQKEILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFV
Query Conservation       
 









 
        
  

     
 


    
  
  
  





 
   
       
   
 
Alig confidence 




























........




.............













...







Template Conservation 

 
 
    




 
 
 
        ........     .............






       ...      
 
Template Sequence  RIILVGKTGTGKSAAGNSILRTCSKSQGS. . . . . . . . WREIV. . . . . . . . . . . . . IIDTPDMFSWKDHC. . . EALYKEVQ
Template Known Secondary structure 

TTS



........

.............

GGGGSS


...
Template Predicted Secondary structure 









........

.............










...
Template SS confidence 















































































   24.....30.........40.........50.. ..... ..60.........70. ........
 
   289290......
Predicted Secondary structure 
Query SS confidence 







Query Sequence  EFHDYLGL
Query Conservation 
       
Alig confidence 







Template Conservation          
Template Sequence  RCYLLSAP
Template Known Secondary structure  TT
Template Predicted Secondary structure 


Template SS confidence 







   97..100....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions