Return to main results Retrieve Phyre Job Id

Job DescriptionP39286
Confidence94.36%DateThu Jan 5 11:58:58 GMT 2012
Rank499Aligned Residues31
% Identity23%Templatec1w5sB_
PDB info PDB header:replicationChain: B: PDB Molecule:origin recognition complex subunit 2 orc2; PDBTitle: structure of the aeropyrum pernix orc2 protein (adp form)
Resolution2.4 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   198.200...... ...210.........220........
Predicted Secondary structure 

............






Query SS confidence 








. . . . . . . . . . . .





















Query Sequence  LKPLEEALT. . . . . . . . . . . . GRISIFAGQSGVGKSSLLNALL
Query Conservation 
  
   
 ............ 
     
 









 
 
Alig confidence 








............





















Template Conservation 
  
   
      
        

 
 
  
 


 

  
 
Template Sequence  AEALARIYLNRLLSGAGLSDVNMIYGSIGRVGIGKTTLAKFTV
Template Known Secondary structure  T



TT

SSS
Template Predicted Secondary structure 













Template SS confidence 










































   31........40.........50.........60.........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions