Return to main results Retrieve Phyre Job Id

Job DescriptionP06996
Confidence2.17%DateThu Jan 5 10:59:51 GMT 2012
Rank68Aligned Residues27
% Identity26%Templatec3egbA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:protein pellino homolog 2; PDBTitle: structure of pellino2 fha domain at 3.3 angstroms2 resolution.
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   323......330.........340.........350.........360..
Predicted Secondary structure 



















Query SS confidence 







































Query Sequence  ATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALG
Query Conservation    
   
   


 
                       

Alig confidence 




















.............





Template Conservation 



 
 
 





  
  
.............





Template Sequence  ISYTLSRNQTVVVEYTHDKDT. . . . . . . . . . . . . DMFQVG
Template Known Secondary structure 
SSS

TT.............
Template Predicted Secondary structure 









.............


Template SS confidence 







































   7980.........90......... 100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions